Keywords

• VIP10
• Vasoactive Intestinal Peptide API
• VIP laboratory reagent

Quick Details

• ProName: VIP10
• Molecular Formula: C147H234N44O42
• Appearance: White to off-white lyophilized powder
• Application: For laboratory scientific research onl...
• DeliveryTime: 3-7 working days after receiving full ...
• PackAge: 5mg/vial,10mg/vial
• Port: Hong Kong, China
• ProductionCapacity: 99999 box/Month
• Purity: ≥99%
• Storage: Store at 2-8℃ for short-term; long-ter...
• Transportation: Keep cold, avoid high temperature and ...
• LimitNum: 1 box
• 有关物质: ≤1.0%
• 炽灼残渣: ≤0.5%
• 重金属: ≤10ppm
• 有效期: 2 years
• Third-party test report: Janoshik lab test available, Purity:99...
• Test Report Number: #11594

Superiority

1. 

2. VIP Vasoactive Intestinal Peptide with high purity ≥99.80%, tested strictly by HPLC and MS, ensure stable and reliable quality for scientific research.
3. Adopt advanced solid-phase peptide synthesis technology, low impurity content, excellent batch consistency, suitable for repeated laboratory comparison experiments.
4. The finished product is white lyophilized powder, good stability under specified storage environment, effectively maintain peptide biological activity.
5. Multiple specifications optional: 5mg/vial and 10mg/vial, flexible to meet different laboratory research dosage demands.
6. Widely used in the research of gastrointestinal function, neuroendocrine regulation, immune response and related preclinical mechanism study.
7. Every batch is fully inspected before delivery, complete supporting documents including COA, HPLC and MS can be provided for your research file record.
8. Factory direct supply, accept small trial orders and large bulk orders, support customized peptide service if you have special requirements.
9. Professional technical support team, provide guidance on dissolution, storage and experimental operation notes for VIP peptide.
10. Strict quality control system, control moisture and acetic acid content within standard range, reduce interference to cell and biological experiments.
11. Sufficient stable inventory, fast order arrangement and quick shipment once payment confirmed.
12. Professional low-temperature light-proof packaging, protect peptide activity during long-distance international transportation.
13. Quick after-sales response, solve your questions about product test data, storage and experimental usage in time.
14. Double inspection before shipment to prevent damaged vials and unqualified products.

Details

VIP, full name Vasoactive Intestinal Peptide. Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 Purity ≥99.80%. Appearance: White lyophilized powder. Available specification:5mg/vial,10mg/vial. Total Impurities: ≤0.2%. Water Content: ≤8.0%. Acetic acid content：≤12%. Shelf Life:2 years.

Description

Vasoactive Intestinal Peptide(VIP) is an important endogenous neuropeptide, composed of 28 amino acid residues. This product is white lyophilized powder, freeze-drying technology effectively protects the biological activity of peptide. This product is research raw material only, limited to scientific laboratory research use. Not for human injection, oral consumption, clinical diagnosis, medical treatment, food or cosmetic addition.

Mechanism of Action

VIP can act as neurotransmitter and neuroendocrine regulatory factor in organisms. It participates in the regulation of gastrointestinal motility, vasodilation, immune function and inflammatory response. It is widely used to explore signal transduction pathways in cell and animal research models.

Application

For in vitro cell culture, biochemical assay, neuropeptide related mechanism research and preclinical laboratory experiments. Main research directions: gastrointestinal physiology, neuroendocrine research, immunology and inflammation related research.

Storage

Short-term storage: 2~8℃, sealed and protected from light. Long-term storage: -20℃, sealed, dry and dark environment. Avoid repeated freeze-thaw cycles, high temperature, strong light exposure and humid environment. Lyophilized peptide is sensitive to temperature and moisture, please keep away from light and moisture during storage and operation.

Warning

For Research Use Only. Not approved for human use, cannot be used for clinical, food, feed or cosmetic purposes. All related experiments must be carried out by professional researchers in qualified laboratory. Please wear protective gloves and goggles when handling the powder, avoid inhalation and skin contact.

Each batch will be fully inspected by HPLC and MS to verify purity and molecular weight. We provide COA, HPLC and MS reports for every shipment for your research records.